Invitrogen™ Human LPA (aa 1571-1619) Control Fragment Recombinant Protein

Product Code. 30197745

Brand: Invitrogen™ RP103900

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (39%), Rat (39%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63883 (PA5-63883. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a serine proteinase that inhibits the activity of tissue-type plasminogen activator I. The encoded protein constitutes a substantial portion of lipoprotein(a) and is proteolytically cleaved, resulting in fragments that attach to atherosclerotic lesions and promote thrombogenesis. Elevated plasma levels of this protein are linked to atherosclerosis. Depending on the individual, the encoded protein contains 2-43 copies of kringle-type domains. The allele represented here contains 15 copies of the kringle-type repeats and corresponds to that found in the reference genome sequence.

Specifications

• Accession Number: P08519
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4018
• Name: Human LPA (aa 1571-1619) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AK38; antiangiogenic AK38 protein; apo(a); APOA; apolipoprotein(a); lipoprotein(a); lipoprotein, Lp(a); LP; lp(a); LPA
• Common Name: LPA
• Gene Symbol: LPA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WEYCNLTQCSETESGVLETPTVVPVPSMEAHSEAAPTEQTPVVRQCYHG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining