Invitrogen™ Human LONRF3 (aa 1-73) Control Fragment Recombinant Protein

Product Code. 30205389

Brand: Invitrogen™ RP108451

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (47%), Rat (47%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84482 (PA5-84482. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants have been suggested, but their full length natures are not clear.

Specifications

• Accession Number: Q496Y0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79836
• Name: Human LONRF3 (aa 1-73) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: LON peptidase N-terminal domain and ring finger 3; LON peptidase N-terminal domain and RING finger protein 3; LONRF3; RING finger protein 127; RNF127
• Common Name: LONRF3
• Gene Symbol: LONRF3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MESVRIEQMLSLPAEVSSDNLESAERGASAAQVDMGPHPKVAAEGPAPLPTREPEQEQSPGTSTPESKVLLTQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining