Invitrogen™ Human LONP1 (aa 383-524) Control Fragment Recombinant Protein

Product Code. 30181517

Brand: Invitrogen™ RP99402

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51692 (PA5-51692. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a mitochondrial matrix protein that belongs to the Lon family of ATP-dependent proteases. This protein mediates the selective degradation of misfolded, unassembled or oxidatively damaged polypeptides in the mitochondrial matrix. It may also have a chaperone function in the assembly of inner membrane protein complexes, and participate in the regulation of mitochondrial gene expression and maintenance of the integrity of the mitochondrial genome. Decreased expression of this gene has been noted in a patient with hereditary spastic paraplegia. Alternatively spliced transcript variants have been found for this gene.

Specifications

• Accession Number: P36776
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9361
• Name: Human LONP1 (aa 383-524) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200017E13Rik; CODASS; h LonHS; HAMAP-Rule:MF_03120}; hLON; hLON ATP-dependent protease; Lon; lon peptidase 1, mitochondrial; lon protease homolog, mitochondrial; lon protease homolog, mitochondrial {ECO:0000255; Lon protease-like protein; lon protease-like protein {ECO:0000255; LONHs; LONP; LONP {ECO:0000255; LONP1; Mitochondrial ATP-dependent protease Lon; mitochondrial ATP-dependent protease Lon {ECO:0000255; mitochondrial lon protease-like protein; PIM1; protease, serine, 15; Prss15; Serine protease 15; serine protease 15 {ECO:0000255
• Common Name: LONP1
• Gene Symbol: LONP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining