Invitrogen™ Human LMO7 (aa 695-838) Control Fragment Recombinant Protein

Product Code. 30202530

Brand: Invitrogen™ RP101072

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54281 (PA5-54281. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The LIM-only (LMO) proteins are nuclear factors characterized by a conserved LIM domain. The LIM domain contains a cysteine-rich zinc-binding motif, present in a variety of transcription factors, including the LIM homeobox (LHX) proteins expressed in the central nervous system. The deduced LMO7 protein is comprised of 1,349 amino acid residues, contains a characteristic zinc finger domain and a 3-prime UTR which possesses a short interspersed nucleotide element (SINE). RT-PCR detects predominant expression of LMO7 in heart, lung, skeletal muscle, and kidney, moderate expression in liver, ovary, brain, pancreas, and testis, and little to no expression in spleen. Research indicates that LMO7 is an afadin- and alpha-actinin-binding protein that connects the nectin-afadin and E-cadherin-catenin systems through alpha-actinin.

Specifications

• Accession Number: Q8WWI1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4008
• Name: Human LMO7 (aa 695-838) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C78582; F-box only protein 20; F-box protein Fb x 20; FB x 20; FBXO20; Gm914; KIAA0858; LIM domain 7; LIM domain only 7; LIM domain only 7 protein; LIM domain only protein 7; LMO7; LMO-7; LOMP; LOMP protein; mKIAA0858; RP11-332E3.2; TGF-beta induced protein; zinc-finger domain-containing protein
• Common Name: LMO7
• Gene Symbol: LMO7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KIYGENGSKSMSDVSAEDVQNLRQLRYEEMQKIKSQLKEQDQKWQDDLAKWKDRRKSYTSDLQKKKEEREEIEKQALEKSKRSSKTFKEMLQDRESQNQKSTVPSRRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEKGATY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining