Invitrogen™ Human LMAN2L (aa 170-307) Control Fragment Recombinant Protein

Product Code. 30208230

Brand: Invitrogen™ RP102041

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55355 (PA5-55355. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be involved in the regulation of export from the endoplasmic reticulum of a subset of glycoproteins. May function as a regulator of ERGIC-53.

Specifications

• Accession Number: Q9H0V9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 81562
• Name: Human LMAN2L (aa 170-307) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A630028F14Rik; Lectin mannose-binding 2-like; lectin, mannose binding 2 like; lectin, mannose-binding 2-like; LMAN2L; LMAN2-like protein; MRT52; PSEC0028; UNQ368/PRO704; VIP36-like; VIP36-like protein; VIPL
• Common Name: LMAN2L
• Gene Symbol: LMAN2L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLPEMTAPLP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining