Invitrogen™ Human Livin (aa 1-67) Control Fragment Recombinant Protein

Product Code. 30211323

Brand: Invitrogen™ RP106157

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (51%), Rat (51%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The inhibitor of apoptosis (IAP) family of proteins regulates programmed cell death triggered by various stimuli. All IAPs have at least one baculovirus IAP repeat (BIR) motif that is essential for their anti-apoptotic activity. Recently, it has been identified that a novel human inhibitor of apoptosis protein (IAP) family member termed Livin or ML-IAP, which contains a single baculoviral IAP repeat (BIR) domain and a COOH-terminal RING finger domain. Livin gene has two splicing variants that contain open reading frames of 298 and 280 amino acids and both contained a single copy of baculovirus IAP repeat (BIR) and RING domain. Both of the isoforms inhibit TNFa induced apoptosis in Jurkat cells. Livin expression is low in adult tissues. It is relatively expressed at a higher level in developmental tissues and in many cancer cells.

Specifications

• Accession Number: Q96CA5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79444
• Name: Human Livin (aa 1-67) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: baculoviral IAP repeat containing 7; baculoviral IAP repeat-containing 7; baculoviral IAP repeat-containing 7 (livin); baculoviral IAP repeat-containing protein 7; Baculoviral IAP repeat-containing protein 7 30 kDa subunit; Baculoviral IAP repeat-containing protein 7 30 kDa subunit; Birc7; E130019N06; KIAP; Kidney inhibitor of apoptosis protein; LIVIN; livin inhibitor of apoptosis; melanoma inhibitor of apoptosis protein; MLIAP; ML-IAP; RGD1562883; RING finger protein 50; RING-type E3 ubiquitin transferase BIRC7; RNF50; RP11-261N11.7; Truncated livin; UNQ5800/PRO19607/PRO21344
• Common Name: Livin
• Gene Symbol: BIRC7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining