Invitrogen™ Human LIPT2 (aa 153-229) Control Fragment Recombinant Protein

Product Code. 30198490

Brand: Invitrogen™ RP97493

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59119 (PA5-59119. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate.

Specifications

• Accession Number: A6NK58
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 387787
• Name: Human LIPT2 (aa 153-229) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Lipoate-protein ligase B; lipoyl(octanoyl) transferase 2 (putative); lipoyl/octanoyl transferase; LIPT2; Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase; putative lipoyltransferase 2, mitochondrial; putative octanoyltransferase, mitochondrial
• Common Name: LIPT2
• Gene Symbol: LIPT2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSKELQRHVTVEEVMPPFLVAFKEIYKCTLISEDS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining