Invitrogen™ Human LIPG (aa 34-169) Control Fragment Recombinant Protein

Product Code. 30209226

Brand: Invitrogen™ RP88732

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82568 (PA5-82568. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LIPG (Lipase G, Endohelial type) is an endothelial lipase which is a novel member of the lipoprotein lipase gene family. LIPG is synthesized by endothelial cells and functions at the site of synthesis. LIPG most likely plays a physiological role in modulating lipoprotein metabolism. Overexpressed LIPG has been shown to reduce HDL cholesterol levels, whereas an LIPG deficiency appears to be effective in elevating HDL cholesterol levels in animals. LIPG has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. Also, LIPG is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family. LIPG is a carboxyl esterase that hydrolyzes high density lipoproteins, emulsifies triglycerides, is essential for the efficient digestion of dietary fats and can bind to heparin.

Specifications

• Accession Number: Q9Y5X9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9388
• Name: Human LIPG (aa 34-169) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3110013K01Rik; EDL; EL; endothelial cell-derived lipase; Endothelial lipase; endothelial-derived lipase; lipase; lipase G; lipase G, endothelial type; lipase, endothelial; LIPG; lipoprotein lipase H; lipose, endothelial; mEDL; PL; PRO719; UNQ387/PRO719
• Common Name: LIPG
• Gene Symbol: LIPG
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLHKPKATQTEVKPSVRFNLRTSKDPEHEGCYLSVGHSQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining