missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201722

Invitrogen™ Human LIPA (aa 198-233) Control Fragment Recombinant Protein

Product Code. 30201722
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201722

Brand: Invitrogen™ RP103288

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84326 (PA5-84326. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes lipase A, the lysosomal acid lipase (also known as cholesterol ester hydrolase). This enzyme functions in the lysosome to catalyze the hydrolysis of cholesteryl esters and triglycerides. Mutations in this gene can result in Wolman disease and cholesteryl ester storage disease. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P38571
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3988
Name Human LIPA (aa 198-233) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA960673; Acid cholesteryl ester hydrolase; CESD; Chole; Chole2; cholesterol ester hydrolase; Cholesterol esterase (pancreatic) see D3Wox12 D3Wox13 D3Wox26 and D3Mgh25; cholesteryl esterase; HGCLAS; HUSSY-01; LAL; LAS; LIAS; Lip1; Lip-1; Lipa; Lipase A; lipase A, lysosomal acid type; lipase A, lysosomal acid, cholesterol esterase; lipoate synthase; Lipoic acid synthase; lipoic acid synthetase; lipoyl synthase, mitochondrial; lip-syn; LS; lysosomal acid lipase; lysosomal acid lipase 1; lysosomal acid lipase A; lysosomal acid lipase/cholesteryl ester hydrolase; pancreatic cholesterol esterase; PDHLD; RP11-341B24.1; Sterol esterase
Common Name LIPA
Gene Symbol LIPA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.