Invitrogen™ Human LINS (aa 548-619) Control Fragment Recombinant Protein

Product Code. 30198395

Brand: Invitrogen™ RP105953

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (28%), Rat (28%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65215 (PA5-65215. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Drosophila segment polarity gene lin encodes a protein, lines, which plays important roles in development of the epidermis and hindgut. This gene encodes a protein containing a lines-like domain. This gene is located on chromosome 15 and clustered with the gene encoding ankyrin repeat and SOCS box-containing protein 7. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q8NG48
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55180
• Name: Human LINS (aa 548-619) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: lines homolog 1; LINS; LINS1; MRT27; Protein Lines homolog 1; WINS1; WINS1 protein with Drosophila Lines (Lin) homologous domain; wnt-signaling molecule Lines homolog 1
• Common Name: LINS
• Gene Symbol: LINS1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TESKYDISICGCVPSLVQDQSSNQTIPHRLTAPHSHRDVCARHSWASDAPSEPLKAVMSKGAHTMCASSLSS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining