Invitrogen™ Human LINGO4 (aa 467-519) Control Fragment Recombinant Protein

Product Code. 30199839

Brand: Invitrogen™ RP101620

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63897 (PA5-63897. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LINGO4 is a protein coding gene.

Specifications

• Accession Number: Q6UY18
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 339398
• Name: Human LINGO4 (aa 467-519) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A530050P17Rik; DAAT9248; LERN4; leucine rich repeat and Ig domain containing 4; leucine rich repeat neuronal 6 D; leucine-rich repeat and immunoglobulin-like domain containing-NOGO receptor-interacting protein 4; Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 4; leucine-rich repeat neuronal protein 6 D; Lingo4; Lrrn6d; PRO34002; RGD1562025; UNQ9248/PRO34002
• Common Name: LINGO4
• Gene Symbol: LINGO4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GTLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNITVP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining