Invitrogen™ Human LIN28B (aa 149-208) Control Fragment Recombinant Protein

Product Code. 30195188

Brand: Invitrogen™ RP95030

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57745 (PA5-57745. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The GNL1 gene, identified in the human major histocompatibility complex class I region, shows a high degree of similarity with its mouse counterpart. The GNL1 gene is located less than 2 kb centromeric to HLA-E, in the same transcriptional orientation. GNL1 is telomeric to HLA-B and HLA-C.

Specifications

• Accession Number: Q6ZN17
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 389421
• Name: Human LIN28B (aa 149-208) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810403D23Rik; CSDD2; D030047M17Rik; lin-28 homolog B; lin-28 homolog B (C. elegans); Lin-28.2; Lin28b; Lin-28 B; Protein lin-28 homolog B
• Common Name: LIN28B
• Gene Symbol: LIN28B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KKCHYCQSIMHMVANCPHKNVAQPPASSQGRQEAESQPCTSTLPREVGGGHGCTSPPFPQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining