Invitrogen™ Human LIMCH1 (aa 426-512) Control Fragment Recombinant Protein

Product Code. 30212736

Brand: Invitrogen™ RP103529

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64136 (PA5-64136. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Actin stress fibers-associated protein that activates non-muscle myosin IIa. Activates the non-muscle myosin IIa complex by promoting the phosphorylation of its regulatory subunit MRLC/MYL9. Through the activation of non-muscle myosin IIa, positively regulates actin stress fibers assembly and stabilizes focal adhesions. It therefore negatively regulates cell spreading and cell migration. [UniProt]

Specifications

• Accession Number: Q9UPQ0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22998
• Name: Human LIMCH1 (aa 426-512) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3732412D22Rik; Kiaa1102; LIM and calponin homology domains 1; LIM and calponin homology domains-containing protein 1; Limch1; LIMCH1A; LMO7B; mKIAA1102
• Common Name: LIMCH1
• Gene Symbol: LIMCH1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LHEAYKNARSQEEAEGILQQYIERFTISEAVLERLEMPKILERSHSTEPNLSSFLNDPNPMKYLRQQSLPPPKFTATVETTIARASV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining