missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human LIF (aa 1-99) Control Fragment Recombinant Protein

Product Code. 30193823
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30193823

Brand: Invitrogen™ RP92359

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Leukemia inhibitory factor (LIF) is a 20 kDa protein that belongs to the IL-6 receptor family. It binds to a heterodimeric membrane receptor made up of a LIF-specific subunit, gp190 or LIFR, and the subunit gp130, which is shared with the other members of the IL-6 family. LIF expression has been observed in various tissues including thymus, lung, and neuronal tissue. LIF can be up-regulated by pro-inflammatory cytokines such as TNFα and IL-17, and elevated levels of LIF have been found in cases of rheumatoid arthritis, neural injury, systemic inflammation, and tuberculosis. LIF displays diverse biological effects, but is best known for its ability to inhibit the differentiation of embryonic stem cells in mice and contribute to stem cell self-renewal.Human and mouse LIF share 79% sequence homology and exhibit cross-species activity. However, LIF inhibition of stem cell differentiation appears to be mouse-specific.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P15018
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3976
Name Human LIF (aa 1-99) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CDF; cholinergic differentiation factor; cholinergic neuronal differentiation factor; d factor; DIA; differentiation inhibitory activity; differentiation-inducing factor; differentiation-stimulating factor; Emfilermin; hepatocyte-stimulating factor III; HILDA; human interleukin in DA cells; leukemia inhibitory factor; leukemia inhibitory factor (cholinergic differentiation factor); LIF; Melanoma-derived LPL inhibitor; MLPLI; myeloid leukaemia inhibitory factor
Common Name LIF
Gene Symbol Lif
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.