missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human LHX9 Partial ORF (NP_001014434.1, 291 a.a. - 388 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

£280.00 - £425.00

Specifications

Accession Number NP_001014434.1
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 56956
Molecular Weight (g/mol) 36.52kDa
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16085595
View Documents Promotion Details
Abnova™
H00056956-Q02.25UG
25 ug
£425.00
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 20-06-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16075595
View Documents Promotion Details
Abnova™
H00056956-Q02.10UG
10 ug
£280.00
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 20-06-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

This gene encodes a member of the LIM homeobox gene family of developmentally expressed transcription factors. The encoded protein contains a homeodomain and two cysteine-rich zinc-binding LIM domains involved in protein-protein interactions. The protein is highly similar to a mouse protein that causes gonadal agenesis when inactivated, suggesting a role in gonadal development. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Sequence: LAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDLTNPTITVVTSVTSNMDSHESGSPSQTTLTNLF
Specifications

Specifications

NP_001014434.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
LHX9
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
56956
LHX9 (Human) Recombinant Protein (Q02)
LAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDLTNPTITVVTSVTSNMDSHESGSPSQTTLTNLF
RUO
LHX9
Recombinant
wheat germ expression system
Videos
SDS
Documents

Documents

Product Certifications