Abnova™ Human LHX9 Partial ORF (NP_001014434.1, 291 a.a. - 388 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Product Code	Brand	Quantity
16085595	Abnova™ H00056956-Q02.25UG	25 ug
16075595	Abnova™ H00056956-Q02.10UG	10 ug

Description

This gene encodes a member of the LIM homeobox gene family of developmentally expressed transcription factors. The encoded protein contains a homeodomain and two cysteine-rich zinc-binding LIM domains involved in protein-protein interactions. The protein is highly similar to a mouse protein that causes gonadal agenesis when inactivated, suggesting a role in gonadal development. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Sequence: LAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDLTNPTITVVTSVTSNMDSHESGSPSQTTLTNLF

Specifications

• Accession Number: NP_001014434.1
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight (g/mol): 36.52kDa
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Common Name: LHX9
• Species: Wheat Germ (in vitro)
• Protein Tag: GST
• Form: Liquid

• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Gene ID (Entrez): 56956
• Name: LHX9 (Human) Recombinant Protein (Q02)
• Immunogen: LAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDLTNPTITVVTSVTSNMDSHESGSPSQTTLTNLF
• Regulatory Status: RUO
• Gene Symbol: LHX9
• Recombinant: Recombinant
• Expression System: wheat germ expression system