Invitrogen™ Human LHX9 (aa 5-105) Control Fragment Recombinant Protein

Product Code. 30203558

Brand: Invitrogen™ RP102526

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LHX9 encodes a member of the LIM homeobox gene family of developmentally expressed transcription factors. The encoded protein contains a homeodomain and two cysteine-rich zinc-binding LIM domains involved in protein-protein interactions. The protein is highly similar to a mouse protein that causes gonadal agenesis when inactivated, suggesting a role in gonadal development.

Specifications

• Accession Number: Q9NQ69
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56956
• Name: Human LHX9 (aa 5-105) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3110009O07Rik; BB104635; LH2B; Lhx9; LIM homeobox 9; LIM homeobox 9-like; LIM homeobox protein 9; LIM homeodomain type transcription factor Lhx9; LIM/homeobox protein Lhx9; LIM-homeobox protein 9; LIM-homeodomain type transcription factor 9; si:dkey-121a9.2; zgc:112196
• Common Name: LHX9
• Gene Symbol: LHX9
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLAL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining