Invitrogen™ Human LHFPL5 (aa 51-91) Control Fragment Recombinant Protein

Product Code. 30209850

Brand: Invitrogen™ RP109978

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144747 (PA5-144747. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in this gene result in deafness in humans, and a mutation in a similar gene in mice results in deafness and vestibular dysfunction with severe degeneration of the organ of Corti. It is proposed to function in hair bundle morphogenesis.

Specifications

• Accession Number: Q8TAF8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 222662
• Name: Human LHFPL5 (aa 51-91) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9330179O15Rik; DFNB67; dJ510O8.8; hscy; LHFPL tetraspan subfamily member 5 protein; Lhfpl5; LHFP-like protein 5; lipoma HMGIC fusion partner-like 5; lipoma HMGIC fusion partner-like 5 protein; Tetraspan membrane protein of hair cell stereocilia; tetraspan transmembrane protein, hair cell stereocilia; TMHS
• Common Name: LHFPL5
• Gene Symbol: LHFPL5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GDSVNTPQAGYFGLFSYCVGNVLSSELICKGGPLDFSSIPS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining