Invitrogen™ Human LGI4 (aa 440-537) Control Fragment Recombinant Protein

Product Code. 30182721

Brand: Invitrogen™ RP99116

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60416 (PA5-60416. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The leucine-rich, glioma inactivated gene 4 (LGI4) is a member of the LGI family in which LGI1 is the exemplar. The LGI family consists of four of highly related proteins containing leucine-rich repeats (LRRs) which are highly similar to other transmembrane signaling molecules and receptors. LGI1 has been identified as a candidate tumor suppressor gene for glioma and plays a role in autodominant lateral temporal epilepsy (ADTLE), an epileptic syndrome characterized by focal seizures with predominant auditory symptoms. Despite its high homology with LGI1 and similar pattern of expression, mutations in LGI4 have not been found to be associated with ADTLE. However, the LGI4 gene is located in a region linked to benign familial infantile convulsions. Further study revealed that a GC-to-AT polymorphism was correlated with childhood absence epilepsy. Other studies showed that decreasing LGI4 expression in cultured cells inhibits myelination, indicating that LGI4 may play a role in neural development.

Specifications

• Accession Number: Q8N135
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 163175
• Name: Human LGI4 (aa 440-537) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: clp; leucine rich repeat LGI family member 4; leucine-rich glioma inactivated protein 4; leucine-rich glioma-inactivated gene 4; leucine-rich glioma-inactivated protein 4; Leucine-rich repeat LGI family member 4; leucine-rich repeat LGI family, member 4; LGI1-like protein 3; LGI4; Lgil3; UNQ6515/PRO21485
• Common Name: LGI4
• Gene Symbol: LGI4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SMFRLLQQLPSRGAHVFQPLLIARDQLAILGSDFAFSQVLRLEPDKGLLEPLQELGPPALVAPRAFAHITMAGRRFLFAACFKGPTQIYQHHEIDLSA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining