Invitrogen™ Human LETM2 (aa 356-421) Control Fragment Recombinant Protein

Product Code. 30195049

Brand: Invitrogen™ RP93882

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55209 (PA5-55209. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LETM2 contains 1 LETM1 domain. The function of the LETM1 protein remains unknown.

Specifications

• Accession Number: Q2VYF4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 137994
• Name: Human LETM2 (aa 356-421) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6030453H13; D030041N04Rik; LETM1 and EF-hand domain-containing protein 2; LETM1 domain-containing protein LETM2, mitochondrial; LETM2; LETM2S; leucine zipper and EF-hand containing transmembrane protein 2; leucine zipper-, EF-hand motif- containing transmembrane protein 2; leucine zipper-, EF-hand motif- containing transmembrane protein 2 S; leucine zipper-EF-hand containing transmembrane protein 1-like protein; leucine zipper-EF-hand containing transmembrane protein 2; Leucine zipper-EF-hand-containing transmembrane protein 1-like
• Common Name: LETM2
• Gene Symbol: LETM2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GLTEEQLRQQLTEWQDLHLKENVPPSLLLLSRTFYLIDVKPKPIEIPLSGEAPKTDILVELPTFTE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining