Invitrogen™ Human Leptin Receptor (aa 334-425) Control Fragment Recombinant Protein

Product Code. 30212085

Brand: Invitrogen™ RP95494

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The leptin (OB-R) receptor is a member of the cytokine receptor superfamily which plays an important role in mammalian body weight homeostasis and energy balance. Ligand-induced activation of the OB-R by the adipose tissue-secreted hormone, leptin, appears to activate downstream signaling events through the Janus kinase (JAK)/signal transducer and activator of transcription (STAT) pathway. Leptin can homo-dimerize OB-R extracellular domains while downstream signaling events are initiated upon homo-dimerization of OB-R intracellular domains. Several isoforms of the OB-R which differ in length and signaling capabilities have been reported. RNA transcripts encoding the OB-R long form have been found in the choroid plexus and in the hypothalamus which has been proposed as a control center for satiety and energy expenditure. Mutations in either the mouse OB-R (db) or leptin (ob) genes have been shown to result in early-onset obesity. Metabolic abnormalities attributable to these genotypes include hypercorticoidemia, hyperinsulinemia and insulin resistance, hyperglycemia, altered CNS activity, reduced metabolic rate of brown adipose tissue, and a large increase in white adipose tissue.

Specifications

• Accession Number: P48357
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3953
• Name: Human Leptin Receptor (aa 334-425) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: B219; CD antigen CD295; CD295; CD295 antigen; db; diabetes; Fa; HuB219; HuB219.2; LEPR; LEP-R; Leprb; LEPRD; LEPROT; leptin receptor; Leptin receptor (fatty); leptin receptor gene-related protein; Modb1; OB receptor; obese-like; obl; Obr; OB-R; OB-RGRP
• Common Name: Leptin Receptor
• Gene Symbol: Lepr
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IYFPPKILTSVGSNVSFHCIYKKENKIVPSKEIVWWMNLAEKIPQSQYDVVSDHVSKVTFFNLNETKPRGKFTYDAVYCCNEHECHHRYAEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining