missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Leptin (aa 95-167) Control Fragment Recombinant Protein

Product Code. 30209598
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209598

Brand: Invitrogen™ RP110030

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Leptin is a 167 amino acid long protein hormone with important effects in regulating body weight, metabolism and reproductive function. Leptin is approximately 16 kDa in mass and encoded by the obese (ob) gene. Leptin is expressed predominantly by adipocytes, which fits with the idea that body weight is sensed as the total mass of fat in the body. Smaller amounts of leptin are also secreted by cells in the epithelium of the stomach and in the placenta. Leptin receptors are highly expressed in areas of the hypothalamus known to be important in regulating body weight, as well as in T lymphocytes and vascular endothelial cells. Leptin's effects on body weight are mediated through effects on hypothalamic centers that control feeding behavior and hunger, body temperature and energy expenditure. Leptin is involved in regulating food intake, energy expenditure, and adiposity through hypothalamic leptin receptors. Leptin promotes hematopoiesis, angiogenesis, wound healing, inflammation, immune responses, influences pubertal development and fetal growth. Studies have investigated the role of leptin in obesity, anorexia nervosa, insulin resistance, and hypertension. Leptin also has thermogenic actions and regulates enzymes of fatty acid oxidation. Severe hereditary obesity in rodents and humans can be caused by defects in leptin production.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P41159
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3952
Name Human Leptin (aa 95-167) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CD295 antigen; H-Leptin; HuB219; Lep; LEPD; LEP-R; Leptin; leptin (murine obesity homolog); leptin (obesity homolog, mouse); leptin precursor; Method: conceptual translation supplied by author.; OB; obese; obese protein; obese, mouse, homolog of; obesity; obesity factor; obesity protein; OB-R; OBS; truncated leptin
Common Name Leptin
Gene Symbol Lep
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.