Invitrogen™ Human LEPREL2 (aa 185-286) Control Fragment Recombinant Protein

Product Code. 30199525

Brand: Invitrogen™ RP108184

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83676 (PA5-83676. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the leprecan family of proteoglycans, which function as collagen prolyl hydroxylases that are required for proper collagen biosynthesis, folding and assembly. This protein, like other family members, is thought to reside in the endoplasmic reticulum. Epigenetic inactivation of this gene is associated with breast and other cancers, suggesting that it may function as a tumor suppressor.

Specifications

• Accession Number: Q8IVL6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10536
• Name: Human LEPREL2 (aa 185-286) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BC016431; gene rich cluster, B; GRCB; HSU47926; leprecan-like 2; leprecan-like protein 2; LEPREL2; P3H3; procollagen-proline 3-dioxygenase; prolyl 3-hydroxylase 3; Protein B
• Common Name: LEPREL2
• Gene Symbol: P3h3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PMHLQMREDMAKYRRMSGVRPQSFRDLETPPHWAAYDTGLELLGRQEAGLALPRLEEALQGSLAQMESCRADCEGPEEQQGAEEEEDGAASQGGLYEAIAGH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining