missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30212977

Invitrogen™ Human LEMD2 (aa 243-361) Control Fragment Recombinant Protein

Product Code. 30212977
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
missing translation for 'unitSize'
100µL
This item is not returnable. View return policy

Product Code. 30212977

missing translation for 'mfr': Invitrogen™ RP89512

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53589 (PA5-53589. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The LEM (lamina-associated polypeptide-emerin-MAN1) domain is a motif shared by a group of lamin-interacting proteins of the inner nuclear membrane (INM) and nucleoplasm. One such protein, LEMD2 (LEM domain-containing protein 2), is a lamina-associated protein in the INM involved in nuclear structure organization, containing an N-terminal LEM motif, two transmembrane domains, and a MAN1-Src1p C-terminal (MSC) domain. LEMD2 is a truncated paralog of MAN1, lacking the MAN1-specific C-terminal RNA-recognition motif, but like MAN1 is required for myogenic differentiation. Mutations in LEMD2 are thought be among the possible causes of muscle disease.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8NC56
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 221496
Name Human LEMD2 (aa 243-361) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BC026588; CTRCT42; dJ482C21.1; hLEM2; LEM domain containing 2; LEM domain-containing protein 2; Lem2; LEMD2; NET25; nuclear envelope constituent; Nuclear envelope transmembrane protein 25
Common Name LEMD2
Gene Symbol LEMD2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EDNMKLLPVDCERKTDEFCQAKQKAALLELLHELYNFLAIQAGNFECGNPENLKSKCIPVMEAQEYIANVTSSSSAKFEAALTWILSSNKDVGIWLKGEDQSELVTTVDKVVCLESAHP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.