Invitrogen™ Human LECT2 (aa 19-82) Control Fragment Recombinant Protein

Product Code. 30212173

Brand: Invitrogen™ RP108957

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139837 (PA5-139837. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a secreted, 16 kDa protein that acts as a chemotactic factor to neutrophils and stimulates the growth of chondrocytes and osteoblasts. This protein has high sequence similarity to the chondromodulin repeat regions of the chicken myb-induced myeloid 1 protein. A polymorphism in this gene may be associated with rheumatoid arthritis.

Specifications

• Accession Number: O14960
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3950
• Name: Human LECT2 (aa 19-82) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: chm2; ChM-II; chondromodulin II; chondromodulin-II; hLECT2; Lect2; LECT-2; leukocyte cell derived chemotaxin 2; leukocyte cell-derived chemotaxin 2; leukocyte cell-derived chemotaxin-2
• Common Name: LECT2
• Gene Symbol: LECT2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining