Invitrogen™ Human LECT1 (aa 118-250) Control Fragment Recombinant Protein

Product Code. 30193643

Brand: Invitrogen™ RP90242

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52698 (PA5-52698. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ChM-1 is a cartilage-specific matrix glycoprotein that stimulates the growth of chondrocytes. ChM-1 inhibits angiogenesis by disrupting the tube formation of endothelial cells and thus is responsible for the avascular nature of cartilage. ChM-1 is strongly expressed by the proliferating and hypertrophic zones in the epiphyseal plate of long bones. ChM-1 accumulates in the interterritorial matrix around the lacunae. During development, downregulation of ChM-1 permits angiogenesis and ultimately bone formation on the cartilage template. ChM-1 expression is downregulated in the presence of several growth factors including TGFβ2, FGF2 and PTHLH. ChM-1 expression may also play a role in the hypovascularity and chondroid formation of pleomorphic adenomas. The gene encoding human ChM-1 maps to chromosome 13q14-q21.

Specifications

• Accession Number: O75829
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11061
• Name: Human LECT1 (aa 118-250) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BRICD3; BRICHOS domain containing 3; CHM1; Chm-1; Chmi; CHM-I; Chondromodulin; Chondromodulin 1; chondromodulin I; chondromodulin-1; Chondromodulin-I; Chondrosurfactant protein; CH-SP; Cnmd; LECT1; leukocyte cell derived chemotaxin 1; leukocyte cell-derived chemotaxin 1; multiple myeloma tumor suppressor 1; MYETS1
• Common Name: LECT1
• Gene Symbol: CNMD
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSKLEGKIMPVKYEENSLIWVAVDQPVKDNSFLSSKVLELCGDLPIFWLKPTYPKEIQRERREVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining