Invitrogen™ Human LDOC1L (aa 59-169) Control Fragment Recombinant Protein

Product Code. 30195037

Brand: Invitrogen™ RP91552

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52186 (PA5-52186. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LDOC1L gene ontology (GO) annotation includes protein binding.

Specifications

• Accession Number: Q6ICC9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84247
• Name: Human LDOC1L (aa 59-169) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6-Mar; BC058638; dJ1033E15.2; gag-like protein; LDOC1L; leucine zipper down-regulated in cancer 1 like; leucine zipper protein down-regulated in cancer cells-like; leucine zipper, down-regulated in cancer 1 like; leucine zipper, down-regulated in cancer 1-like; mammalian retrotransposon-derived protein 6; MAR6; MART6; protein LDOC1L; Protein Sushi-15E3; Retrotransposon Gag-like protein 6; Rtl6; Sushi-15E3
• Common Name: LDOC1L
• Gene Symbol: RTL6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SVMAELTLLRTRARIPGALQITPPISSITSNGTRPMTTPPTSLPEPFSGDPGRLAGFLMQMDRFMIFQASRFPGEAERVAFLVSRLTGEAEKWAIPHMQPDSPLRNNYQGF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining