Invitrogen™ Human LDB3 (aa 198-272) Control Fragment Recombinant Protein

Product Code. 30209756

Brand: Invitrogen™ RP100928

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83935 (PA5-83935. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a PDZ domain-containing protein. PDZ motifs are modular protein-protein interaction domains consisting of 80-120 amino acid residues. PDZ domain-containing proteins interact with each other in cytoskeletal assembly or with other proteins involved in targeting and clustering of membrane proteins. The protein encoded by this gene interacts with alpha-actinin-2 through its N-terminal PDZ domain and with protein kinase C via its C-terminal LIM domains. The LIM domain is a cysteine-rich motif defined by 50-60 amino acids containing two zinc-binding modules. This protein also interacts with all three members of the myozenin family. Mutations in this gene have been associated with myofibrillar myopathy and dilated cardiomyopathy. Alternatively spliced transcript variants encoding different isoforms have been identified; all isoforms have N-terminal PDZ domains while only longer isoforms (1, 2 and 5) have C-terminal LIM domains.

Specifications

• Accession Number: O75112
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11155
• Name: Human LDB3 (aa 198-272) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW742271; cardiomyopathy, dilated 1 C (autosomal dominant); CMD1C; CMH24; CMPD3; cypher; FLJ35865; HGNC:15710; KIAA01613; KIAA0613; LDB3; LDB3Z1; LDB3Z4; LIM domain binding 3; LIM domain-binding protein 3; LVNC3; MFM4; ORACLE; oracle protein; PDLIM6; PDZ and LIM domain 6; PDZ-LIM domain protein; protein cypher; Protein oracle; RGD1564875; ZASP; Z-band alternatively spliced PDZ motif protein; Z-band alternatively spliced PDZ-motif protein
• Common Name: LDB3
• Gene Symbol: LDB3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PIGLYSAETLREMAQMYQMSLRGKASGVGLPGGSLPIKDLAVDSASPVYQAVIKSQNKPEDEADEWARRSSNLQS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining