Invitrogen™ Human LDB1 (aa 37-89) Control Fragment Recombinant Protein

Product Code. 30198796

Brand: Invitrogen™ RP95733

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56948 (PA5-56948. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LIM domain-binding protein 1 (LDB1), also known as Carboxyl-terminal LIM domain-binding protein 2 (CLIM2), binds to the LIM domain of a wide variety of LIM domain-containing transcription factors. LDB1 may regulate the transcriptional activity of LIM-containing proteins by determining specific partner interactions. It plays a role in the development of interneurons and motor neurons in cooperation with LHX3 and ISL1. LDB1 acts synergistically with LHX1/LIM1 in axis formation and activation of gene expression. It also acts with LMO2 in the regulation of red blood cell development, maintaining erythroid precursors in an immature state. LDB1 strongly interacts with the LIM2 domain of LMX1A to form homodimer. LDB1 protein is expressed in a wide range of adult tissues including brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes. Due to alternative splicing events, three isoforms exist for LDB1.

Specifications

• Accession Number: Q86U70
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8861
• Name: Human LDB1 (aa 37-89) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: carboxy terminal LIM domain protein 2; carboxyl-terminal LIM domain-binding protein 2; CLIM2; CLIM-2; hLdb1; Ldb1; LDB-1; LIM domain binding 1; LIM domain-binding factor CLIM2; LIM domain-binding factor-1; LIM domain-binding protein 1; mLdb1; NLI; Nuclear LIM interactor
• Common Name: LDB1
• Gene Symbol: LDB1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECDNLW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining