Invitrogen™ Human LCTL (aa 64-114) Control Fragment Recombinant Protein

Product Code. 30203005

Brand: Invitrogen™ RP107829

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67189 (PA5-67189. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of family 1 glycosidases. Glycosidases are enzymes that hydrolyze glycosidic bonds and are classified into families based on primary amino acid sequence. Most members of family 1 have two conserved glutamic acid residues, which are required for enzymatic activity. The mouse ortholog of this protein has been characterized and has a domain structure of an N-terminal signal peptide, glycosidase domain, transmembrane domain, and a short cytoplasmic tail. It lacks one of the conserved glutamic acid residues important for catalysis, and its function remains to be determined. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q6UWM7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 197021
• Name: Human LCTL (aa 64-114) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: KL lactase phlorizin hydrolase; KLG; klotho gamma; klotho/lactase-phlorizin hydrolase-related protein; KLPH; lactase like; lactase-like; lactase-like protein; LCTL; UNQ3022/PRO9820
• Common Name: LCTL
• Gene Symbol: LCTL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SIWDVFTHSGKGKVLGNETADVACDGYYKVQEDIILLRELHVNHYRFSLSW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining