Invitrogen™ Human LCORL (aa 380-475) Control Fragment Recombinant Protein

Product Code. 30211701

Brand: Invitrogen™ RP95540

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55980 (PA5-55980. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May act as transcription activator that binds DNA elements with the sequence 5'-CCCTATCGATCGATCTCTACCT-3'. May play a role in spermatogenesis.

Specifications

• Accession Number: Q8N3X6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 254251
• Name: Human LCORL (aa 380-475) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: fi43c07; im:7138788; Lcorl; LCoR-like protein; LCORLp1; LCORLp2; ligand dependent nuclear receptor corepressor like; ligand dependent nuclear receptor corepressor-like; ligand-dependent nuclear receptor corepressor-like protein; MBLK1-related protein; mblk1-related protein 1; Mblk1-related protein-1; MLR1; RGD1561241; si:dkeyp-26a9.6; Transcription factor MLR1; wu:fi43c07
• Common Name: LCORL
• Gene Symbol: LCORL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TYLHQLTLQKMVTQFKEKNESLQYETSNPTVQLKIPQLRVSSVSKSQPDGSGLLDVMYQVSKTSSVLEGSALQKLKNILPKQNKIECSGPVTHSSV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining