Invitrogen™ Human LCOR (aa 183-266) Control Fragment Recombinant Protein

Product Code. 30195672

Brand: Invitrogen™ RP95761

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56741 (PA5-56741. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LCOR is a transcriptional corepressor widely expressed in fetal and adult tissues that is recruited to agonist-bound nuclear receptors through a single LxxLL motif, also referred to as a nuclear receptor (NR) box.

Specifications

• Accession Number: Q96JN0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84458
• Name: Human LCOR (aa 183-266) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3110023F06Rik; A630025C20Rik; C10orf12; KIAA1795; Lcor; ligand dependent nuclear receptor corepressor; ligand-dependent corepressor; Mblk1-related protein 2; Mblk1-related protein-2; mKIAA1795; MLR2; RGD1311704; transcription factor MLR2
• Common Name: LCOR
• Gene Symbol: LCOR
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HGQHLILSREASWAKPHYEFNLSRMKFRGNGALSNISDLPFLAENSAFPKMALQAKQDGKKDVSHSSPVDLKIPQVRGMDLSWE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining