missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human LCMT2 (aa 320-417) Control Fragment Recombinant Protein

Product Code. 30205523
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205523

Brand: Invitrogen™ RP104849

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83898 (PA5-83898. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TYW4 is an enzyme that participates in the wybutosine-tRNA (Phe) biosynthesis pathway. Wybutosine (yW) is a hypermodified guanosine at the 3-prime position adjacent to the anticodon of phenylalanine tRNA that stabilizes codon-anticodon interactions during decoding on the ribosome. TYW4 is involved in a multistep enzymatic reaction that stabilizes codon-anticodon base-pairing during the ribosomal decoding process, thereby ensuring correct translation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O60294
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9836
Name Human LCMT2 (aa 320-417) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias D330024M17; KIAA0547; LCMT2; Leucine carboxyl methyltransferase 2; p21WAF1/CIP1 promoter-interacting protein; PPM2; tRNA wybutosine-synthesizing protein 4; tRNA wybutosine-synthesizing protein 4 homolog; tRNA yW-synthesizing protein 4; tRNA yW-synthesizing protein 4 homolog; tRNA(Phe) (7-(3-amino-3-(methoxycarbonyl)propyl)wyosine(37)-N)-methoxycarbonyltransferase; tRNA(Phe) (7-(3-amino-3-carboxypropyl)wyosine(37)-O)-methyltransferase; tRNA-Wybutosine-synthesizing protein 4; tRNA-yW synthesizing protein 4; TYW4
Common Name LCMT2
Gene Symbol LCMT2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TLVFPSSEAFPRVNPASPSGVFPASVVSSEGQVPNLKRYGHASVFLSPDVILSAGGFGEQEGRHCRVSQFHLLSRDCDSEWKGSQIGSCGTGVQWDGR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.