Invitrogen™ Human LATS2 (aa 521-590) Control Fragment Recombinant Protein

Product Code. 30213229

Brand: Invitrogen™ RP97249

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83451 (PA5-83451. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LATS2 is a serine/threonine protein kinase belonging to the LATS tumor suppressor family. LATS2 interacts with a negative regulator of p53 and function in a positive feedback loop with p53 that responds to cytoskeleton damage and this interaction provokes centrosome/mitotic apparatus dysfunction. LATS2 plays an essential role in the maintenance of mitotic fidelity and genomic integrity. LATS2 plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. It negatively regulates G1/S transition by down-regulating cyclin E/CDK2 kinase activity.

Specifications

• Accession Number: Q9NRM7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26524
• Name: Human LATS2 (aa 521-590) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4932411G09Rik; AV277261; AW228608; h-warts; Kinase phosphorylated during mitosis protein; KPM; large tumor suppressor 2; large tumor suppressor homolog 2; large tumor suppressor kinase 2; large tumor suppressor, homolog 2; LATS (large tumor suppressor, Drosophila) homolog 2; LATS, large tumor suppressor, homolog 2; LATS2; serine/threonine kinase KPM; serine/threonine-protein kinase kpm; Serine/threonine-protein kinase LATS2; si:ch211-173o4.2; Warts-like kinase
• Common Name: LATS2
• Gene Symbol: LATS2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HLLLRSKSEQYDLDSLCAGMEQSLRAGPNEPEGGDKSRKSAKGDKGGKDKKQIQTSPVPVRKNSRDEEKR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining