missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Lass2 (aa 326-379) Control Fragment Recombinant Protein

Product Code. 30207967
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207967

Brand: Invitrogen™ RP109685

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LASS2 is a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. This gene encodes a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. Alternatively spliced transcript variants encoding the same protein have been described.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96G23
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 29956
Name Human Lass2 (aa 326-379) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610013I17Rik; AI225939; ceramide synthase 2; CERS2; FLJ10243; L3; LAG1 homolog, ceramide synthase 2; LAG1 longevity assurance 2; LAG1 longevity assurance homolog 2; LAG1 longevity assurance homolog 2; ceramide synthase 2; LASS2; longevity assurance (LAG1, S. cerevisiae) homolog 2; longevity assurance homolog 2; MGC987; SP260; Sphingosine N-acyltransferase CERS2; TMSG1; TRAM homolog 3; translocating chain-associating membrane protein homolog 3; Trh3; Tumor metastasis-suppressor gene 1 protein
Common Name Lass2
Gene Symbol CERS2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MAHKFITGKLVEDERSDREETESSEGEEAAAGGGAKSRPLANGHPILNNNHRKN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.