Invitrogen™ Human LARP7 (aa 418-495) Control Fragment Recombinant Protein

Product Code. 30211461

Brand: Invitrogen™ RP91861

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55437 (PA5-55437. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LARP7 gene ontology annotations related to this gene include RNA processing.

Specifications

• Accession Number: Q4G0J3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51574
• Name: Human LARP7 (aa 418-495) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ALAZS; C330027G06Rik; D3Wsu161e; DKFZP564K112; HDCMA18P; La ribonucleoprotein 7, transcriptional regulator; La ribonucleoprotein domain family member 7; La ribonucleoprotein domain family, member 7; la-related protein 7; la-related protein 7; LOW QUALITY PROTEIN: la-related protein 7; Larp7; PIP7S; P-TEFb-interaction protein for 7 SK stability; Unknown (protein for IMAGE:8171460); Unknown (protein for IMAGE:8281412)
• Common Name: LARP7
• Gene Symbol: LARP7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DSGVPQNTGMKNEKTANREECRTQEKVNATGPQFVSGVIVKIISTEPLPGRKQVRDTLAAISEVLYVDLLEGDTECHA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining