missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Lano (aa 448-522) Control Fragment Recombinant Protein

Product Code. 30211907
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211907

Brand: Invitrogen™ RP94870

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56792 (PA5-56792. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Lano is a member of the LAP (leucine-rich repeats and PDZ) family of proteins that also includes Densin-180, Erbin, and hScribble. The LAP proteins generally contain multiple leucine-rich repeat (LRR) domains which serve to target them to the basolateral membrane of epithelial cells. Lano is unique in that it alone does not possess one or more PDZ (PSD95/DLG/ZO-1) domains as do the other members of the LAP family. However, it can bind to the PDZ domain of Erbin in addition to those of membrane-associated and guanylate kinase (MAGUK) proteins which regulate adhesion and plasticity at cell junctions. It has been suggested that it is through these interaction that these LAP proteins participate in the maintenance of proper embryonic development and integrity of epithelial tissues.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BTT6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55227
Name Human Lano (aa 448-522) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A430093J20Rik; AU016091; D030059I21; dJ523E19.1; LANO; LANO adapter protein; LAP (leucine-rich repeats and PDZ) and no PDZ protein; LAP and no PDZ protein; leucine rich repeat containing 1; leucine-rich repeat-containing 1; leucine-rich repeat-containing protein 1; LRRC1; mKIAA4018; RP3-523E19.1
Common Name Lano
Gene Symbol LRRC1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NERAVNRVSAIRFVEDEKDEEDNETRTLLRRATPHPGELKHMKKTVENLRNDMNAAKGLDSNKNEVNHAIDRVTT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.