Invitrogen™ Human LAMTOR4 (aa 1-99) Control Fragment Recombinant Protein

Product Code. 30203516

Brand: Invitrogen™ RP92832

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54301 (PA5-54301. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LAMTOR4 is a part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. LAMTOR4 is activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. LAMTOR4 is activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated.

Specifications

• Accession Number: Q0VGL1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 389541
• Name: Human LAMTOR4 (aa 1-99) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0910001L09Rik; AV006840; C7orf59; Lamtor4; Late endosomal/lysosomal adaptor and MAPK and MTOR activator 4; late endosomal/lysosomal adaptor, MAPK and MTOR activator 4; ragulator complex protein LAMTOR4; Ragulator complex protein LAMTOR4, N-terminally processed; RGD1309735; UPF0539 protein C7orf59; UPF0539 protein C7orf59 homolog
• Common Name: LAMTOR4
• Gene Symbol: LAMTOR4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining