Invitrogen™ Human LAMTOR2 (aa 3-118) Control Fragment Recombinant Protein

Product Code. 30207681

Brand: Invitrogen™ RP102170

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52056 (PA5-52056. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The late endosomal/lysosomal adaptor MAPK and MTOR activator 2 (LAMTOR2) protein belongs to the LAMTOR family of proteins, and together with LAMTOR3 and the MAPK1 and ERK kinase 1 (MEK1) localizes to late endosomes where it is required for the efficient activation of ERK signaling. This complex is involved in the regulation of late endosomal traffic and cellular proliferation and plays a role in cellular host defense against Salmonella infection.

Specifications

• Accession Number: Q9Y2Q5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 28956
• Name: Human LAMTOR2 (aa 3-118) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010111E04Rik; AL022628; ENDAP; Endosomal adaptor protein p14; HSPC003; LAMTOR2; Late endosomal/lysosomal adaptor and MAPK and MTOR activator 2; late endosomal/lysosomal adaptor, MAPK and MTOR activator 2; late endosomal/lysosomal MP1 interacting protein; late endosomal/lysosomal Mp1-interacting protein; MAPBP-interacting protein; Mapbpip; MAPKSP1 adaptor protein; MAPKSP1AP; mitogen activated protein binding protein interacting protein; mitogen-activated protein binding protein interacting protein; mitogen-activated protein-binding protein-interacting protein; mitogen-activated protein-binding protein-interacting protein (MAPBPIP); P14; Rab25; ragulator complex protein LAMTOR2; Ragulator2; RGD1562501; roadblock domain containing 3; roadblock domain-containing protein 3; ROBLD3
• Common Name: LAMTOR2
• Gene Symbol: LAMTOR2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining