missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human LAMTOR2 (aa 3-118) Control Fragment Recombinant Protein

Product Code. 30207681
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207681

Brand: Invitrogen™ RP102170

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52056 (PA5-52056. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The late endosomal/lysosomal adaptor MAPK and MTOR activator 2 (LAMTOR2) protein belongs to the LAMTOR family of proteins, and together with LAMTOR3 and the MAPK1 and ERK kinase 1 (MEK1) localizes to late endosomes where it is required for the efficient activation of ERK signaling. This complex is involved in the regulation of late endosomal traffic and cellular proliferation and plays a role in cellular host defense against Salmonella infection.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y2Q5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 28956
Name Human LAMTOR2 (aa 3-118) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2010111E04Rik; AL022628; ENDAP; Endosomal adaptor protein p14; HSPC003; LAMTOR2; Late endosomal/lysosomal adaptor and MAPK and MTOR activator 2; late endosomal/lysosomal adaptor, MAPK and MTOR activator 2; late endosomal/lysosomal MP1 interacting protein; late endosomal/lysosomal Mp1-interacting protein; MAPBP-interacting protein; Mapbpip; MAPKSP1 adaptor protein; MAPKSP1AP; mitogen activated protein binding protein interacting protein; mitogen-activated protein binding protein interacting protein; mitogen-activated protein-binding protein-interacting protein; mitogen-activated protein-binding protein-interacting protein (MAPBPIP); P14; Rab25; ragulator complex protein LAMTOR2; Ragulator2; RGD1562501; roadblock domain containing 3; roadblock domain-containing protein 3; ROBLD3
Common Name LAMTOR2
Gene Symbol LAMTOR2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.