missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Laminin gamma-3 (aa 324-456) Control Fragment Recombinant Protein

Product Code. 30196852
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196852

Brand: Invitrogen™ RP102087

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54610 (PA5-54610. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Laminin is a non-collagenous protein of basement membranes. By rotary shadowing it has a cross-like shape, consisting of one long arm, (400 kD) and three short arms (200 kD). Antibodies to laminin localize exclusively in basement membranes. Laminin is found throughout the basement membrane, but the reaction with the antibodies to laminin is more intense in the lamina lucida, the part of the basement membrane adjacent to the cell membrane. Laminin binds to type IV collagen, a component exclusively localized in the basement membrane. Laminin has been shown to play a role in cell adhesion and attachment in vivo and in vitro.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y6N6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10319
Name Human Laminin gamma-3 (aa 324-456) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI562206; AW240805; Lamc3; laminin gamma 3; Laminin gamma3; laminin subunit gamma 3; laminin subunit gamma-3; laminin, gamma 3; laminin-12 subunit gamma; Laminin-14 subunit gamma; laminin-15 subunit gamma; OCCM
Common Name Laminin gamma-3
Gene Symbol LAMC3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CLPCNCSGRSEECTFDRELFRSTGHGGRCHHCRDHTAGPHCERCQENFYHWDPRMPCQPCDCQSAGSLHLQCDDTGTCACKPTVTGWKCDRCLPGFHSLSEGGCRPCTCNPAGSLDTCDPRSGRCPCKENVEG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.