Invitrogen™ Human Laminin gamma-3 (aa 324-456) Control Fragment Recombinant Protein

Product Code. 30196852

Brand: Invitrogen™ RP102087

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54610 (PA5-54610. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Laminin is a non-collagenous protein of basement membranes. By rotary shadowing it has a cross-like shape, consisting of one long arm, (400 kD) and three short arms (200 kD). Antibodies to laminin localize exclusively in basement membranes. Laminin is found throughout the basement membrane, but the reaction with the antibodies to laminin is more intense in the lamina lucida, the part of the basement membrane adjacent to the cell membrane. Laminin binds to type IV collagen, a component exclusively localized in the basement membrane. Laminin has been shown to play a role in cell adhesion and attachment in vivo and in vitro.

Specifications

• Accession Number: Q9Y6N6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10319
• Name: Human Laminin gamma-3 (aa 324-456) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI562206; AW240805; Lamc3; laminin gamma 3; Laminin gamma3; laminin subunit gamma 3; laminin subunit gamma-3; laminin, gamma 3; laminin-12 subunit gamma; Laminin-14 subunit gamma; laminin-15 subunit gamma; OCCM
• Common Name: Laminin gamma-3
• Gene Symbol: LAMC3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CLPCNCSGRSEECTFDRELFRSTGHGGRCHHCRDHTAGPHCERCQENFYHWDPRMPCQPCDCQSAGSLHLQCDDTGTCACKPTVTGWKCDRCLPGFHSLSEGGCRPCTCNPAGSLDTCDPRSGRCPCKENVEG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining