Invitrogen™ Human Laminin alpha-1 Control Fragment Recombinant Protein

Product Code. 30205700

Brand: Invitrogen™ RP108162

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Laminin antibodies are widely used to label blood vessels and basement membranes.

Specifications

• Accession Number: P25391
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 284217
• Name: Human Laminin alpha-1 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: LAMA; LAMA1; Laminin A chain; laminin subunit alpha 1; laminin subunit alpha-1; laminin, alpha 1; Laminin-1 subunit alpha; Laminin-3 subunit alpha; PTBHS; S-LAM alpha; S-LAM-alpha; S-laminin subunit alpha
• Common Name: Laminin alpha-1
• Gene Symbol: LAMA1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LIVQGRGLIDAAAAQTDAVQDALEHLEDHQDKLLLWSAKIRHHIDDLVMHMSQRNAVDLVYRAEDHATEFQRLADVLYSGLENIRNVSLNATSAA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining