Invitrogen™ Human LACTB Control Fragment Recombinant Protein

Product Code. 30211576

Brand: Invitrogen™ RP95825

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57626 (PA5-57626. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). The encoded protein has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.

Specifications

• Accession Number: P83111
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 114294
• Name: Human LACTB Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: G24; Lact1; LACT-1; lactamase beta; lactamase, beta; Lactb; mitochondrial 39 S ribosomal protein L56; mitochondrial ribosomal protein L56; MRPL56; serine beta lactamase-like protein; serine beta-lactamase-like protein LACTB, mitochondrial; UNQ843/PRO1781
• Common Name: LACTB
• Gene Symbol: LACTB
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NSNENLLPGYLKPETMVMMWTPVPNTEMSWDKEGKYAMAWGVVEKKQTYGSCRKQRHYASHTGGAVGASSVLLVLPEELDTETINNKVP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining