Invitrogen™ Human L3MBTL3 (aa 99-173) Control Fragment Recombinant Protein

Product Code. 30211878

Brand: Invitrogen™ RP93657

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84139 (PA5-84139. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Putative Polycomb group (PcG) protein. PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility.

Specifications

• Accession Number: Q96JM7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84456
• Name: Human L3MBTL3 (aa 99-173) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI481284; H-l(3)mbt-like protein 3; KIAA1798; l(3)mbt-like 3; l(3)mbt-like 3 (Drosophila); l(3)mbt-like protein 3; L3MBTL histone methyl-lysine binding protein 3; L3mbtl3; L3MBTL3, histone methyl-lysine binding protein; lethal(3)malignant brain tumor-like protein 3; lethal(3)malignant brain tumor-like protein 3; LOW QUALITY PROTEIN: lethal(3)malignant brain tumor-like protein 3; MBT1; MBT-1
• Common Name: L3MBTL3
• Gene Symbol: L3MBTL3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SEKTGMPFRLKDPVKVEGLQFCENCCQYGNVDECLSGGNYCSQNCARHIKDKDQKEERDVEEDNEEEDPKCSRKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining