Invitrogen™ Human L-Plastin (aa 18-77) Control Fragment Recombinant Protein

Product Code. 30203193

Brand: Invitrogen™ RP92382

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82679 (PA5-82679. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

L-plastin is a leukocyte specific actin bundling protein from fimbrin family of proteins. It has two actin-binding domains and two EF hand type calcium-binding domains. It gets phosphorylated on the serine residue in its headpiece region in response to a variety of inflammatory stimuli. It is hypothesized that L-plastin may play a role in regulating integrin mediated adhesion in leukocytes. L-plastin is expressed in majority of human cancer cell lines derived from solid tumors. Its expression is positively upregulated by testosterones in androgen receptor positive prostrate and breast cancer cells through three androgen receptor binding elements located in the upstream region of the gene.

Specifications

• Accession Number: P13796
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3936
• Name: Human L-Plastin (aa 18-77) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 65 kDa macrophage protein; AW536232; bA139H14.1 (lymphocyte cytosolic protein 1 (L-plastin)); cb245; CP64; D14Ertd310e; DKFZp781A23186; epididymis secretory protein Li 37; fj24b12; FLJ25423; FLJ26114; FLJ39956; HEL-S-37; LC64P; LCP1; LCP-1; leucocyte-specific plastin 1; L-fimbrin; LPL; L-plastin; L-plastin (Lymphocyte cytosolic protein 1) (LCP-1) (65 kDa macrophage protein) (PP65); L-plastin (Lymphocyte cytosolic protein 1) (LCP-1) (LC64P); lymphocyte cytosolic plastin 1; lymphocyte cytosolic protein 1; lymphocyte cytosolic protein 1 (L-plastin); Lymphocyte cytosolic protein-1 (plasmin); plastin 2; plastin 2, L; plastin-2; Pls2; pp65; wu:fj24b12
• Common Name: L-Plastin
• Gene Symbol: LCP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining