Invitrogen™ Human L-Myc (aa 33-88) Control Fragment Recombinant Protein

Product Code. 30211629

Brand: Invitrogen™ RP105255

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66558 (PA5-66558. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cellular DNA-binding proteins encoded by the c-myc genes. They are normally involved in nucleic acid metabolism and in mediating the cellular response to growth factors. Elevated and deregulated (constitutive) expression of c-myc proteins can cause tumorigenesis. L-Myc gene ontology annotations include DNA binding function, DNA-binding transcription factor activity, RNA polymerase II-specific action, protein dimerization activity, and regulation of inner ear auditory receptor cell differentiation.

Specifications

• Accession Number: P12524
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4610
• Name: Human L-Myc (aa 33-88) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Avian myelocytomatosis viral (v-myc) related oncogene homolog 1, lung carcinoma derived (Lmyc); AW536278; bHLHe38; Class E basic helix-loop-helix protein 38; LMYC; L-MYC; Lmyc1; Lmyc-1; l-myc-1 proto-oncogene; MYCL; MYCL proto-oncogene, bHLH transcription factor; Mycl1; myc-related gene from lung cancer; Protein L-Myc; protein L-Myc-1; v-myc avian myelocytomatosis viral oncogene lung carcinoma derived homolog; V-myc myelocytomatosis viral oncogene homolog; v-myc myelocytomatosis viral oncogene homolog 1, lung carcinoma derived; v-myc myelocytomatosis viral oncogene homolog, lung carcinoma derived (avian)
• Common Name: L-Myc
• Gene Symbol: MYCL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYAS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining