missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human KV4.1 (KCND1) (aa 56-155) Control Fragment Recombinant Protein

Product Code. 30196873
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196873

Brand: Invitrogen™ RP91925

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-64866 (PA5-64866, PA5-51505 (PA5-51505. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The KV gene family encodes more than 30 genes that comprise the subunits of the K+ channels, and they vary in their gating and permeation properties, subcellular distribution and expression patterns. Functional KV channels assemble as tetramers consisting of pore-forming alpha-subunits (KV alpha), which include the KV1, KV2, KV3 and KV4 proteins, and accessory or KV beta subunits that modify the gating properties of the coexpressed KV alpha subunits. Differences exist in the patterns of trafficking, biosynthetic processing and surface expression of the major KV1 subunits (KV1. 1, KV1. 2 and KV1. 4) expressed in rat and human brain, suggesting that the individual protein subunits are highly regulated to control for the assembly and formation of functional neuronal channels.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NSA2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3750
Name Human KV4.1 (KCND1) (aa 56-155) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110037K09Rik; Kca2-1; Kcnd1; KV4.1; mShal; mShal1; potassium channel, voltage gated Shal related subfamily D, member 1; potassium channel, voltage gated Shal-related subfamily D, member 1; potassium voltage gated channel Shal-related family member 1; potassium voltage gated channel, Shal-related family, member 1; potassium voltage-gated channel subfamily D member 1; potassium voltage-gated channel, Shal-related family, member 1; potassium voltage-gated channel, Shal-related subfamily, member 1; Shal; Shal1; Shal-type potassium channel; Voltage-gated potassium channel subunit Kv4.1
Common Name KV4.1 (KCND1)
Gene Symbol Kcnd1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NTLDRYPDTLLGSSEKEFFYDADSGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAFYGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.