missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human KV3.4 (KCNC4) (aa 2-69) Control Fragment Recombinant Protein

Product Code. 30207317
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207317

Brand: Invitrogen™ RP91089

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53226 (PA5-53226. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes. It generates atypical voltage-dependent transient current that may be important for neuronal excitability. Several transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q03721
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3749
Name Human KV3.4 (KCNC4) (aa 2-69) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI850292; C1orf30; HKSHIIIC; K+ channel subunit; KCNC4; Kcr2-4; KSHIIIC; Kv3.4; MGC126818; potassium channel, voltage gated Shaw related subfamily C, member 4; potassium channel, voltage gated Shaw-related subfamily C, member 4; potassium voltage gated channel, Shaw-related subfamily, member 4; potassium voltage-gated channel subfamily C member 4; potassium voltage-gated channel subfamily C member 4 (Voltage-gated potassium channel subunit Kv3.4) (Raw3); potassium voltage-gated channel, Shaw-related subfamily, member 4; raw3; Voltage-gated potassium channel subunit Kv3.4
Common Name KV3.4 (KCNC4)
Gene Symbol KCNC4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGTRLAWLADPD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.