Invitrogen™ Human KV3.3 (KCNC3) (aa 554-659) Control Fragment Recombinant Protein

Product Code. 30196013

Brand: Invitrogen™ RP91145

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53714 (PA5-53714. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes.

Specifications

• Accession Number: Q14003
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3748
• Name: Human KV3.3 (KCNC3) (aa 554-659) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: KCNC3; Kcr2-3; KShIIID; KV3.3; LOW QUALITY PROTEIN: potassium voltage-gated channel subfamily C member 3; potassium channel, voltage gated Shaw related subfamily C, member 3; potassium channel, voltage gated Shaw-related subfamily C, member 3; potassium voltage gated channel, Shaw-related subfamily, member 3; potassium voltage-gated channel subfamily C member 3; potassium voltage-gated channel, Shaw-related subfamily, member 3; SCA13; Shaw type potassium channel Kv3.3; Shaw-related voltage-gated potassium channel protein 3; voltage-gated potassium channel protein KV3.3; voltage-gated potassium channel subunit Kv3.3
• Common Name: KV3.3 (KCNC3)
• Gene Symbol: KCNC3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLPKKKNKHIPRPPQPGSPNYCKPDPPPPPPPHPHHGSGGISPPPPITPPSMGVTVAGAYPAGPHTHPGLLRGGAGGLGIMGLPPLPAPGEPCPLAQEEVIEINRA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining