missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human KV1.1 (KCNA1) (aa 426-494) Control Fragment Recombinant Protein

Product Code. 30201151
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201151

Brand: Invitrogen™ RP109410

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments, and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif. The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q09470
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3736
Name Human KV1.1 (KCNA1) (aa 426-494) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AEMK; AI840627; brain potassium channel protein-1; EA1; HBK1; HUK1; IA; Kca1-1; Kcna; Kcna1; Kcpvd; Kv1.1; MBK1; mceph; megencephaly; MGC126782; MGC138385; MK1; Mk-1; MKI; potassium (K+) channel protein voltage dependent; potassium channel, voltage gated shaker related subfamily A, member 1; potassium voltage gated channel shaker related subfamily member 1; potassium voltage gated channel, shaker related subfamily, member 1; potassium voltage-gated channel subfamily A member 1; potassium voltage-gated channel, shaker-related subfamily, member 1; potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia); RBK1; RBKI; RCK1; Shak; Voltage-gated K(+) channel HuKI; voltage-gated potassium channel HBK1; Voltage-gated potassium channel subunit Kv1.1
Common Name KV1.1 (KCNA1)
Gene Symbol Kcna1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.