Invitrogen™ Human KV1.1 (KCNA1) (aa 426-494) Control Fragment Recombinant Protein

Code produit. 30201151

Marque: Invitrogen™ RP109410

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments, and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif. The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia.

Spécification

• Accession Number: Q09470
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3736
• Name: Human KV1.1 (KCNA1) (aa 426-494) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AEMK; AI840627; brain potassium channel protein-1; EA1; HBK1; HUK1; IA; Kca1-1; Kcna; Kcna1; Kcpvd; Kv1.1; MBK1; mceph; megencephaly; MGC126782; MGC138385; MK1; Mk-1; MKI; potassium (K+) channel protein voltage dependent; potassium channel, voltage gated shaker related subfamily A, member 1; potassium voltage gated channel shaker related subfamily member 1; potassium voltage gated channel, shaker related subfamily, member 1; potassium voltage-gated channel subfamily A member 1; potassium voltage-gated channel, shaker-related subfamily, member 1; potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia); RBK1; RBKI; RCK1; Shak; Voltage-gated K(+) channel HuKI; voltage-gated potassium channel HBK1; Voltage-gated potassium channel subunit Kv1.1
• Common Name: KV1.1 (KCNA1)
• Gene Symbol: Kcna1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining