Invitrogen™ Human Ku80 (aa 306-448) Control Fragment Recombinant Protein

Product Code. 30198442

Brand: Invitrogen™ RP89469

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is the 80-kilodalton subunit of the Ku heterodimer protein which is also known as ATP-dependant DNA helicase II or DNA repair protein XRCC5. Ku is the DNA-binding component of the DNA-dependent protein kinase, and it functions together with the DNA ligase IV-XRCC4 complex in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. This gene functionally complements Chinese hamster xrs-6, a mutant defective in DNA double-strand break repair and in ability to undergo V(D)J recombination. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity.

Specifications

• Accession Number: P13010
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7520
• Name: Human Ku80 (aa 306-448) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 86 kDa subunit of Ku antigen; AI314015; ATP-dependent DNA helicase 2 subunit 2; ATP-dependent DNA helicase II 80 kDa subunit; CTC box-binding factor 85 kDa subunit; CTC85; CTCBF; DNA repair protein XRCC5; FLJ39089; G22p2; HGNC:12833; KARP1; KARP-1; Ku autoantigen; ku autoantigen protein p86 homolog; Ku autoantigen, 80 kD); Ku autoantigen, 80 kDa; Ku p80; Ku80; Ku-80; Ku86; Ku-86; Ku86 autoantigen related protein 1; KUB2; Kup80; Lupu; lupus; lupus Ku autoantigen protein p86; NFIV; nuclear factor IV; OTTHUMP00000164061; OTTHUMP00000206791; Thyroid-lupus autoantigen; TLAA; X-ray repair complementing defective repair in Chinese hamster cells 5; X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining); X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining; Ku autoantigen, 80 kDa); X-ray repair cross complementation (double-strand-break rejoining; X-ray repair cross complementation (double-strand-break rejoining; Ku autoantigen, 80 kD); X-ray repair cross complementing 5; X-ray repair cross-complementing protein 5; Xrcc5
• Common Name: Ku80
• Gene Symbol: XRCC5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining